Dmc1 (NM_010059) Mouse Recombinant Protein

CAT#: TP522831

Purified recombinant protein of Mouse DNA meiotic recombinase 1 (Dmc1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR222831 representing NM_010059
Red=Cloning site Green=Tags(s)

MKEDQVVQEESGFQDDEESLFQDIDLLQKHGINMADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKV
EKIKEAANKLIEPGFLTAFQYSERRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLC
VTAQLPGTGGYSGGKIIFIDTENTFRPDRLRDIADRFNVDHEAVLDNVLYARAYTSEHQMELLDYVAAKF
HEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTF
QADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 37.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_034189
Locus ID 13404
UniProt ID Q61880, Q14AN8
Refseq Size 2227
Cytogenetics 15 37.79 cM
Refseq ORF 1020
Synonyms Dmc1h; Lim15; Mei1; Mei11; sg; sgdp
Summary This gene encodes a member of the superfamily of recombinases (also called DNA strand-exchange proteins). Recombinases are important for repairing double-strand DNA breaks during mitosis and meiosis. This protein, which is evolutionarily conserved, is reported to be essential for meiotic homologous recombination and may thus play an important role in generating diversity of genetic information. In mouse, deficiency of this gene causes infertility. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...