Fkbp6 (NM_033571) Mouse Recombinant Protein
CAT#: TP523506
Purified recombinant protein of Mouse FK506 binding protein 6 (Fkbp6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR223506 representing NM_033571
Red=Cloning site Green=Tags(s) MSVFSRLRNGIPPSRDDCQSPYERLSQRMLDISGDRGVLKDIIREGTGDTVTPDASVLVKYSGYLEHMDK PFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRKGELARFLFKPAYAYGTLGCPPLIPPNATVLFEIELI DFLDSAESDKFCALSAEQQEQFPLQKVLKVAATEREFGNYLFRQNRFCDAKVRYKRALLLLHRRLATCEE QHLVEPAVLLVLLNLSFVYLKLDRPAMALRYGEQALLIDKRNAKALFRCGQACLLLTEYERARDFLVRAQ KEQPCNHDINNELKKLSSHYRDYVDREREMCHRMFAPCGSRSSVGGN myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 37.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_291049 |
Locus ID | 94244 |
UniProt ID | Q91XW8 |
Refseq Size | 1447 |
Cytogenetics | 5 75.11 cM |
Refseq ORF | 981 |
Synonyms | 36kDa; 1700008G22Rik; AU017274; D5Ertd724; D5Ertd724e; FKBP-6; FKBP-36 |
Summary | This gene is a member of the FK506-binding protein (Fkbp) family. The encoded protein plays a role in male-specific fertility and homologous pairing of chromosomes during meiosis. The protein may also be involved in LINE1 transposon silencing and binding to Hsp90 as a co-chaperone. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2013] |
Documents
FAQs |
SDS |