Rpe65 (NM_029987) Mouse Recombinant Protein

CAT#: TP523598

Purified recombinant protein of Mouse retinal pigment epithelium 65 (Rpe65), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR223598 representing NM_029987
Red=Cloning site Green=Tags(s)

MSIQIEHPAGGYKKLFETVEELSSPLTAHVTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLFDGQALLHKF
DFKEGHVTYHRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCKNIFSRFFSYFKGVEVTDNALVNIYPVG
EDYYACTETNFITKINPETLETIKQVDLCNYISVNGATAHPHIESDGTVYNIGNCFGKNFTVAYNIIKIP
PLKADKEDPINKSEVVVQFPCSDRFKPSYVHSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFE
SNESMGVWLHVADKKRRKYFNNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENW
EEVKRNAMKAPQPEVRRYVLPLTIDKVDTGRNLVTLPHTTATATLRSDETIWLEPEVLFSGPRQAFEFPQ
INYQKFGGKPYTYAYGLGLNHFVPDKLCKMNVKTKEIWMWQEPDSYPSEPIFVSQPDALEEDDGVVLSVV
VSPGAGQKPAYLLVLNAKDLSEIARAEVETNIPVTFHGLFKRS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 61.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_084263
Locus ID 19892
UniProt ID Q91ZQ5
Refseq Size 1862
Cytogenetics 3 82.52 cM
Refseq ORF 1599
Synonyms 65kDa; A930029L06Rik; LCA2; Mord1; rd12; RP20
Summary Critical isomerohydrolase in the retinoid cycle involved in regeneration of 11-cis-retinal, the chromophore of rod and cone opsins. Catalyzes the cleavage and isomerization of all-trans-retinyl fatty acid esters to 11-cis-retinol which is further oxidized by 11-cis retinol dehydrogenase to 11-cis-retinal for use as visual chromophore (PubMed:15765048, PubMed:9843205, PubMed:23407971, PubMed:28500718). Essential for the production of 11-cis retinal for both rod and cone photoreceptors (PubMed:17251447). Also capable of catalyzing the isomerization of lutein to meso-zeaxanthin an eye-specific carotenoid. The soluble form binds vitamin A (all-trans-retinol), making it available for LRAT processing to all-trans-retinyl ester. The membrane form, palmitoylated by LRAT, binds all-trans-retinyl esters, making them available for IMH (isomerohydrolase) processing to all-cis-retinol. The soluble form is regenerated by transferring its palmitoyl groups onto 11-cis-retinol, a reaction catalyzed by LRAT (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...