Prdx5 (NM_012021) Mouse Recombinant Protein

CAT#: TP524040

Purified recombinant protein of Mouse peroxiredoxin 5 (Prdx5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR224040 representing NM_012021
Red=Cloning site Green=Tags(s)

MLQLGLRVLGCKASSVLRASTCLAGRAGRKEAGWECGGARSFSSSAVTMAPIKVGDAIPSVEVFEGEPGK
KVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFVIEEWGRAHQAE
GKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMVIDNGIVKALNVEPDGTGLTCSLAPNILSQL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 21.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_036151
Locus ID 54683
UniProt ID P99029
Refseq Size 688
Cytogenetics 19 5.08 cM
Refseq ORF 633
Synonyms AOEB1; AOEB166; AOPP; P; PLP; PMP; Pmp20; Prd; Prdx6; PrxV
Summary This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. The use of alternate transcription start sites may result in use of alternate in-frame translation start codons that generate alternate isoforms that are targeted to the mitochondrion or peroxisome/cytoplasm. [provided by RefSeq, Nov 2017]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...