Foxl2 (NM_012020) Mouse Recombinant Protein
CAT#: TP525684
Purified recombinant protein of Mouse forkhead box L2 (Foxl2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR225684 representing NM_012020
Red=Cloning site Green=Tags(s) MMASYPEPEDTAGTLLAPESGRAVKEAEASPPSPGKGGGTTPEKPDPAQKPPYSYVALIAMAIRESAEKR LTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNYR RRRRMKRPFRPPPAHFQPGKGLFGSGGAAGGCGVPGAGADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMP YASCQMAAAAAAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGPYSRVQSMALPPGVVNSYNGLGGPPAAP PPPPPPPHPHPHPHAHHLHAAAAPPPAPPHHGAAAPPPGQLSPASPATAAPPAPAPTSAPGLQFACARQP ELAMMHCSYWDHDSKTGALHSRLDL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 39.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036150 |
Locus ID | 26927 |
UniProt ID | O88470 |
Refseq Size | 2520 |
Cytogenetics | 9 E3.3 |
Refseq ORF | 1125 |
Synonyms | AU045128; BPES; Pfrk; PINTO |
Summary | Transcriptional regulator. Critical factor essential for ovary differentiation and maintenance, and repression of the genetic program for somatic testis determination. Prevents trans-differentiation of ovary to testis through transcriptional repression of the Sertoli cell-promoting gene SOX9. Has apoptotic activity in ovarian cells. Suppresses ESR1-mediated transcription of PTGS2/COX2 stimulated by tamoxifen. Activates SIRT1 transcription under cellular stress conditions. Activates transcription of OSR2. Is a regulator of CYP19 expression. Is a transcriptional repressor of STAR. Participates in SMAD3-dependent transcription of FST via the intronic SMAD-binding element.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |