Gip (NM_008119) Mouse Recombinant Protein

CAT#: TP526309

Purified recombinant protein of Mouse gastric inhibitory polypeptide (Gip), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR226309 protein sequence
Red=Cloning site Green=Tags(s)

MVALKTCSLLLVLLFLAVGLGEKEEVEFRSHAKFAGPRPRGPRYAEGTFISDYSIAMDKIRQQDFVNWLL
AQRGKKSDWKHNITQREARALVLAGQSQGKEDKEAQGSSLPKSLSDDDVLRDLLIQELLAWMVDQTELCR
LRSQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 16.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_032145
Locus ID 14607
UniProt ID P48756
Refseq Size 649
Cytogenetics 11 D
Refseq ORF 435
Summary This gene encodes an incretin hormone that belongs to the glucagon superfamily. The encoded preproprotein undergoes proteolytic processing to generate mature peptides that function as potent stimulators of insulin secretion and inhibit gastric acid secretion. Transgenic mice overexpressing the encoded protein exhibit a significant increase in the expression of markers of bone formation, a decrease in the expression of markers of bone resorption and, an increase in the bone mass. [provided by RefSeq, Nov 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...