E4 (NC_001460) Virus Tagged ORF Clone
CAT#: VC100278
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040934
View other clones from "Virus" (35)
Need custom modification / cloning service?
Get a free quote
CNY 3,800.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100278 represents NCBI reference of NP_040934 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCAAAGGGACCGAAGATACCGATATAGGCTGGCTCCGTACAACAAGTATCAACTGCCACCTTGTGAAG AACAAAGTAAGGCAACCCTTAGCACAAGCGAGAACTCACTGTGGCCAGAGTGCAACTCACTGACCCTGCA TAACGTATCTGAAGTTAGGGGCATACCCTCATGCGTCGGGTTCACAGTGCTGCAGGAATGGCCAATCCCT TGGGATATGATTCTGACTGACTACGAGATGTTTATCCTGAAAAAGTATATGTCTGTGTGTATGTGCTGCG CTACAATTAACGTGGAAGTCACACAGCTCCTGCACGGACATGAACGCTGGCTTATCCACTGCCACTGCCA GAGGCCTGGATCCCTGCAGTGTATGTCCGCTGGCATGCTGCTGGGACGGTGGTTCAAGATGGCCGTGTAC GGAGCCCTCATCAACAAGCGCTGTTTTTGGTACAGAGAGGTTGTCAATCACCTCATGCCAAAGGAGGTTA TGTATGTAGGCAGCACATTTGTTCGAGGTAGGCACCTGATCTATTTTAAGATCATGTACGATGGGCACGC ATGGCTGGCGCTGGAGAAAGTCTCATTTGGCTGGTCTGCATTCAACTACGGCATCCTGAATAACATGCTG GTCTTGTGTTGCGACTATTGTAAAGACCTCTCCGAAATAAGGATGAGATGTTGCGCAAGGCGAACGAGGC TCTTGATGTTGAAGGTCGTGCAGGTGATCGCCGAGAATACTGTGCGGCCCCTGAAGCACAGCCGACACGA ACGCTATAGGCAGCAGCTGCTGAAGGGACTGATCATGCACCATCGCGCCATCCTGTTCGGCGATTATAAT CAGCGCGAAAATCCCTGGGCCGCGGACGGCCAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100278 representing NP_040934
Red=Cloning sites Green=Tags MQRDRRYRYRLAPYNKYQLPPCEEQSKATLSTSENSLWPECNSLTLHNVSEVRGIPSCVGFTVLQEWPIP WDMILTDYEMFILKKYMSVCMCCATINVEVTQLLHGHERWLIHCHCQRPGSLQCMSAGMLLGRWFKMAVY GALINKRCFWYREVVNHLMPKEVMYVGSTFVRGRHLIYFKIMYDGHAWLALEKVSFGWSAFNYGILNNML VLCCDYCKDLSEIRMRCCARRTRLLMLKVVQVIAENTVRPLKHSRHERYRQQLLKGLIMHHRAILFGDYN QRENPWAADGH TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001460 |
ORF Size | 873 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_001460.1, NP_040934 |
RefSeq ORF | 873 bp |
Locus ID | 1460865 |
MW | 34.4 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100254 | Myc-DDK-tagged ORF clone of viral ORF for E1A gene product [Human adenovirus A], codon optimized for human cell expression, NP_040910 |
CNY 3,800.00 |
|
VC100255 | Myc-DDK-tagged ORF clone of viral ORF for E1B gene product [Human adenovirus A], codon optimized for human cell expression, NP_040911 |
CNY 3,800.00 |
|
VC100256 | Myc-DDK-tagged ORF clone of viral ORF for E1B gene product [Human adenovirus A], codon optimized for human cell expression, NP_040912 |
CNY 5,890.00 |
|
VC100257 | Myc-DDK-tagged ORF clone of viral ORF for IX gene product [Human adenovirus A], codon optimized for human cell expression, NP_040913 |
CNY 3,800.00 |
|
VC100258 | Myc-DDK-tagged ORF clone of viral ORF for IVa2 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040914 |
CNY 5,510.00 |
|
VC100259 | Myc-DDK-tagged ORF clone of viral ORF for E2B gene product [Human adenovirus A], codon optimized for human cell expression, NP_040915 |
CNY 17,860.00 |
|
VC100260 | Myc-DDK-tagged ORF clone of viral ORF for L1 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040916 |
CNY 3,800.00 |
|
VC100261 | Myc-DDK-tagged ORF clone of viral ORF for E2B gene product [Human adenovirus A], codon optimized for human cell expression, NP_040917 |
CNY 7,700.00 |
|
VC100262 | Myc-DDK-tagged ORF clone of viral ORF for L1 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040918 |
CNY 4,470.00 |
|
VC100263 | Myc-DDK-tagged ORF clone of viral ORF for L1 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040919 |
CNY 7,030.00 |
|
VC100264 | Myc-DDK-tagged ORF clone of viral ORF for L2 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040920 |
CNY 6,080.00 |
|
VC100265 | Myc-DDK-tagged ORF clone of viral ORF for L2 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040921 |
CNY 4,090.00 |
|
VC100266 | Myc-DDK-tagged ORF clone of viral ORF for L2 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040922 |
CNY 3,800.00 |
|
VC100267 | Myc-DDK-tagged ORF clone of viral ORF for L3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040923 |
CNY 3,800.00 |
|
VC100268 | Myc-DDK-tagged ORF clone of viral ORF for L3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040924 |
CNY 13,870.00 |
|
VC100269 | Myc-DDK-tagged ORF clone of viral ORF for L3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040925 |
CNY 3,800.00 |
|
VC100270 | Myc-DDK-tagged ORF clone of viral ORF for E2A-L gene product [Human adenovirus A], codon optimized for human cell expression, NP_040926 |
CNY 5,890.00 |
|
VC100271 | Myc-DDK-tagged ORF clone of viral ORF for L4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040927 |
CNY 11,880.00 |
|
VC100272 | Myc-DDK-tagged ORF clone of viral ORF for L4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040928 |
CNY 3,800.00 |
|
VC100273 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040929 |
CNY 3,800.00 |
|
VC100274 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040930 |
CNY 3,800.00 |
|
VC100275 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040932 |
CNY 3,800.00 |
|
VC100276 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040931 |
CNY 3,800.00 |
|
VC100277 | Myc-DDK-tagged ORF clone of viral ORF for L5 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040933 |
CNY 7,030.00 |
|
VC100279 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040935 |
CNY 3,800.00 |
|
VC100280 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_040936 |
CNY 3,800.00 |
|
VC100281 | Myc-DDK-tagged ORF clone of viral ORF for L4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_597783 |
CNY 3,800.00 |
|
VC100282 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, NP_597784 |
CNY 3,800.00 |
|
VC100283 | Myc-DDK-tagged ORF clone of viral ORF for L4 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640219 |
CNY 3,800.00 |
|
VC100284 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640220 |
CNY 3,800.00 |
|
VC100285 | Myc-DDK-tagged ORF clone of viral ORF for E3 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640221 |
CNY 3,800.00 |
|
VC100286 | Myc-DDK-tagged ORF clone of viral ORF for U gene product, partial [Human adenovirus A], codon optimized for human cell expression, YP_002640222 |
CNY 3,800.00 |
|
VC100287 | Myc-DDK-tagged ORF clone of viral ORF for L2 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640218 |
CNY 3,800.00 |
|
VC100288 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640223 |
CNY 3,800.00 |
|
VC100289 | Myc-DDK-tagged ORF clone of viral ORF for E4 gene product [Human adenovirus A], codon optimized for human cell expression, YP_002640224 |
CNY 3,800.00 |