ATPase Inhibitory Factor 1 (ATPIF1) (NM_178191) Human Mass Spec Standard
CAT#: PH313993
ATPIF1 MS Standard C13 and N15-labeled recombinant protein (NP_835498)
View other "ATPase Inhibitory Factor 1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ATPIF1 MS Standard C13 and N15-labeled recombinant protein (NP_835498) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213993 |
Predicted MW | 3.8 kDa |
Protein Sequence |
>RC213993 representing NM_178191
Red=Cloning site Green=Tags(s) MAVTALAARTWLGVWGVRTMQARGFGSDQSENVDRGAGSIREAGGAFGKREQAEEERYFR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_835498 |
RefSeq Size | 1929 |
RefSeq ORF | 180 |
Synonyms | ATPI; ATPIF1; ATPIP; IP |
Locus ID | 93974 |
Cytogenetics | 1p35.3 |
Summary | This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406020 | ATPIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414048 | ATPIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406020 | Transient overexpression lysate of ATPase inhibitory factor 1 (ATPIF1), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3,080.00 |
|
LY414048 | Transient overexpression lysate of ATPase inhibitory factor 1 (ATPIF1), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
PH301920 | ATPIF1 MS Standard C13 and N15-labeled recombinant protein (NP_057395) |
CNY 19,520.00 |
|
TP301920 | Recombinant protein of human ATPase inhibitory factor 1 (ATPIF1), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP313993 | Recombinant protein of human ATPase inhibitory factor 1 (ATPIF1), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg |
CNY 2,900.00 |
其它ATPase Inhibitory Factor 1产品