ATPase Inhibitory Factor 1 (ATPIF1) (NM_016311) Human Recombinant Protein
CAT#: TP301920
Recombinant protein of human ATPase inhibitory factor 1 (ATPIF1), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
View other "ATPase Inhibitory Factor 1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201920 protein sequence
Red=Cloning site Green=Tags(s) MAVTALAARTWLGVWGVRTMQARGFGSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAAL KKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057395 |
Locus ID | 93974 |
UniProt ID | Q9UII2 |
Refseq Size | 560 |
Cytogenetics | 1p35.3 |
Refseq ORF | 318 |
Synonyms | ATPI; ATPIF1; ATPIP; IP |
Summary | This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406020 | ATPIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414048 | ATPIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406020 | Transient overexpression lysate of ATPase inhibitory factor 1 (ATPIF1), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3,080.00 |
|
LY414048 | Transient overexpression lysate of ATPase inhibitory factor 1 (ATPIF1), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
PH301920 | ATPIF1 MS Standard C13 and N15-labeled recombinant protein (NP_057395) |
CNY 19,520.00 |
|
PH313993 | ATPIF1 MS Standard C13 and N15-labeled recombinant protein (NP_835498) |
CNY 19,520.00 |
|
TP313993 | Recombinant protein of human ATPase inhibitory factor 1 (ATPIF1), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg |
CNY 2,900.00 |
其它ATPase Inhibitory Factor 1产品