United States
Germany
Japan
United Kingdom
China
PAFAH1B3 (NM_001145939) Human Mass Spec Standard
CAT＃: PH327227
PAFAH1B3 MS Standard C13 and N15-labeled recombinant protein (NP_001139411)
View other "PAFAH1B3" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Description | PAFAH1B3 MS Standard C13 and N15-labeled recombinant protein (NP_001139411) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227227 |
| Predicted MW | 25.7 kDa |
| Protein Sequence |
>RC227227 protein sequence
Red=Cloning site Green=Tags(s) MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNF GIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLP RGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHS LLLRLLAQDQGQGAPLLEPAP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001139411 |
| RefSeq Size | 1108 |
| RefSeq ORF | 693 |
| Synonyms | PAFAHG |
| Locus ID | 5050 |
| Cytogenetics | 19q13.2 |
| Summary | This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with cognitive disability, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Ether lipid metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400914 | PAFAH1B3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429044 | PAFAH1B3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429045 | PAFAH1B3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400914 | Transient overexpression lysate of platelet-activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa) (PAFAH1B3), transcript variant 2 |
CNY 3,080.00 |
|
| LY429044 | Transient overexpression lysate of platelet-activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa) (PAFAH1B3), transcript variant 1 |
CNY 3,080.00 |
|
| LY429045 | Transient overexpression lysate of platelet-activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa) (PAFAH1B3), transcript variant 3 |
CNY 3,080.00 |
|
| PH301268 | PAFAH1B3 MS Standard C13 and N15-labeled recombinant protein (NP_002564) |
CNY 19,520.00 |
|
| PH327237 | PAFAH1B3 MS Standard C13 and N15-labeled recombinant protein (NP_001139412) |
CNY 19,520.00 |
|
| TP301268 | Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa (PAFAH1B3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP327227 | Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa (PAFAH1B3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP327237 | Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa (PAFAH1B3), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它PAFAH1B3产品
