PAFAH1B3 (NM_001145939) Human Recombinant Protein
CAT#: TP327227
Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa (PAFAH1B3), transcript variant 1, 20 µg
View other "PAFAH1B3" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227227 protein sequence
Red=Cloning site Green=Tags(s) MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNF GIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLP RGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHS LLLRLLAQDQGQGAPLLEPAP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001139411 |
Locus ID | 5050 |
UniProt ID | Q15102 |
Refseq Size | 1108 |
Cytogenetics | 19q13.2 |
Refseq ORF | 693 |
Synonyms | PAFAHG |
Summary | This gene encodes an acetylhydrolase that catalyzes the removal of an acetyl group from the glycerol backbone of platelet-activating factor. The encoded enzyme is a subunit of the platelet-activating factor acetylhydrolase isoform 1B complex, which consists of the catalytic beta and gamma subunits and the regulatory alpha subunit. This complex functions in brain development. A translocation between this gene on chromosome 19 and the CDC-like kinase 2 gene on chromosome 1 has been observed, and was associated with cognitive disability, ataxia, and atrophy of the brain. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Ether lipid metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400914 | PAFAH1B3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429044 | PAFAH1B3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429045 | PAFAH1B3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400914 | Transient overexpression lysate of platelet-activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa) (PAFAH1B3), transcript variant 2 |
CNY 3,080.00 |
|
LY429044 | Transient overexpression lysate of platelet-activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa) (PAFAH1B3), transcript variant 1 |
CNY 3,080.00 |
|
LY429045 | Transient overexpression lysate of platelet-activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa) (PAFAH1B3), transcript variant 3 |
CNY 3,080.00 |
|
PH301268 | PAFAH1B3 MS Standard C13 and N15-labeled recombinant protein (NP_002564) |
CNY 19,520.00 |
|
PH327227 | PAFAH1B3 MS Standard C13 and N15-labeled recombinant protein (NP_001139411) |
CNY 19,520.00 |
|
PH327237 | PAFAH1B3 MS Standard C13 and N15-labeled recombinant protein (NP_001139412) |
CNY 19,520.00 |
|
TP301268 | Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa (PAFAH1B3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP327237 | Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa (PAFAH1B3), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它PAFAH1B3产品