United States
Germany
Japan
United Kingdom
China
Annexin VII (ANXA7) (NM_001156) Human Recombinant Protein
CAT＃: TP301226
Recombinant protein of human annexin A7 (ANXA7), transcript variant 1, 20 µg
View other "Annexin VII" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201226 protein sequence
Red=Cloning site Green=Tags(s) MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPGGYPAPG GYPGAPQPGGAPSYPGVPPGQGFGVPPGGAGFSGYPQPPSQSYGGGPAQVPLPGGFPGGQMPSQYPGGQP TYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYG KDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSE FGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRS FPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRI VVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIVGQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 50.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001147 |
| Locus ID | 310 |
| UniProt ID | P20073 |
| Refseq Size | 2146 |
| Cytogenetics | 10q22.2 |
| Refseq ORF | 1398 |
| Synonyms | ANX7; SNX; SYNEXIN |
| Summary | Annexin VII is a member of the annexin family of calcium-dependent phospholipid binding proteins.The Annexin VII gene contains 14 exons and spans approximately 34 kb of DNA. An alternatively spliced cassette exon results in two mRNA transcripts of 2.0 and 2.4 kb which are predicted to generate two protein isoforms differing in their N-terminal domain. The alternative splicing event is tissue specific and the mRNA containing the cassette exon is prevalent in brain, heart and skeletal muscle. The transcripts also differ in their 3'-non coding regions by the use of two alternative poly(A) signals. Annexin VII encodes a protein with a molecular weight of approximately 51 kDa with a unique, highly hydrophobic N-terminal domain of 167 amino acids and a conserved C-terminal region of 299 amino acids. The latter domain is composed of alternating hydrophobic and hydrophilic segments. Structural analysis of the protein suggests that Annexin VII is a membrane binding protein with diverse properties, including voltage-sensitive calcium channel activity, ion selectivity and membrane fusion. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400464 | ANXA7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418291 | ANXA7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY400464 | Transient overexpression lysate of annexin A7 (ANXA7), transcript variant 1 |
CNY 3,080.00 |
|
| LY418291 | Transient overexpression lysate of annexin A7 (ANXA7), transcript variant 2 |
CNY 4,840.00 |
|
| PH301226 | ANXA7 MS Standard C13 and N15-labeled recombinant protein (NP_001147) |
CNY 19,520.00 |
|
| PH321723 | ANXA7 MS Standard C13 and N15-labeled recombinant protein (NP_004025) |
CNY 19,520.00 |
|
| TP321723 | Recombinant protein of human annexin A7 (ANXA7), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP720184 | Recombinant protein of human annexin A7 (ANXA7), transcript variant 1 |
CNY 1,800.00 |
其它Annexin VII产品
