Apoptosis enhancing nuclease (AEN) (NM_022767) Human Recombinant Protein
CAT#: TP302285
Recombinant protein of human apoptosis enhancing nuclease (AEN), 20 µg
View other "Apoptosis enhancing nuclease" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 6,281.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202285 protein sequence
Red=Cloning site Green=Tags(s) MVPREAPESAQCLCPSLTIPNAKDVLRKRHKRRSRQHQRFMARKALLQEQGLLSMPPEPGSSPLPTPFGA ATATEAASSGKQCLRAGSGSAPCSRRPAPGKASGPLPSKCVAIDCEMVGTGPRGRVSELARCSIVSYHGD VLYDKYIRPEMPIADYRTRWSGITRQHMRKAVPFQVAQKEILKLLKGKVVVGHALHNDFQALKYVHPRSQ TRDTTYVPNFLSEPGLHTRARVSLKDLALQLLHKKIQVGQHGHSSVEDATTAMELYRLVEVQWEQQEARS LWTCPEDREPDSSTDMEQYMEDQYWPDDLAHGSRGGAREAQDRRN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_073604 |
Locus ID | 64782 |
UniProt ID | Q8WTP8 |
Refseq Size | 3134 |
Cytogenetics | 15q26.1 |
Refseq ORF | 975 |
Synonyms | ISG20L1; pp12744 |
Summary | Exonuclease with activity against single- and double-stranded DNA and RNA. Mediates p53-induced apoptosis. When induced by p53 following DNA damage, digests double-stranded DNA to form single-stranded DNA and amplifies DNA damage signals, leading to enhancement of apoptosis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402942 | AEN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402942 | Transient overexpression lysate of apoptosis enhancing nuclease (AEN) |
CNY 3,080.00 |
|
PH302285 | AEN MS Standard C13 and N15-labeled recombinant protein (NP_073604) |
CNY 19,520.00 |
其它Apoptosis enhancing nuclease产品