MAD2 (MAD2L1) (NM_002358) Human Recombinant Protein
CAT#: TP303273
Recombinant protein of human MAD2 mitotic arrest deficient-like 1 (yeast) (MAD2L1), 20 µg
View other "MAD2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203273 protein sequence
Red=Cloning site Green=Tags(s) MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVE QLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVT FLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002349 |
Locus ID | 4085 |
UniProt ID | Q13257 |
Refseq Size | 1453 |
Cytogenetics | 4q27 |
Refseq ORF | 615 |
Synonyms | HSMAD2; MAD2 |
Summary | MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
The HuR CMLD-2 inhibitor exhibits antitumor effects via MAD2 downregulation in thyroid cancer cells
,null,
Scientific Reports
,PubMed ID 31089242
[MAD2L1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400849 | MAD2L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400849 | Transient overexpression lysate of MAD2 mitotic arrest deficient-like 1 (yeast) (MAD2L1) |
CNY 3,080.00 |
|
PH303273 | MAD2L1 MS Standard C13 and N15-labeled recombinant protein (NP_002349) |
CNY 19,520.00 |