LXR beta (NR1H2) (NM_007121) Human Recombinant Protein
CAT#: TP308381
Recombinant protein of human nuclear receptor subfamily 1, group H, member 2 (NR1H2), 20 µg
View other "LXR beta" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208381 protein sequence
Red=Cloning site Green=Tags(s) MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPE RKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRK CQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQQESQSQSQSPVGPQGSSSSASGPGASPGGSEAGSQ GSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQ EIVDFAKQVPGFLQLGREDQIALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFI NPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPR MLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Surface Plasmon Ressonance (SPR) (PMID: 27489280) |
Reference Data | |
RefSeq | NP_009052 |
Locus ID | 7376 |
UniProt ID | P55055 |
Refseq Size | 2093 |
Cytogenetics | 19q13.33 |
Refseq ORF | 1383 |
Synonyms | LXR-b; LXRB; NER; NER-I; RIP15; UNR |
Summary | The liver X receptors, LXRA (NR1H3; MIM 602423) and LXRB, form a subfamily of the nuclear receptor superfamily and are key regulators of macrophage function, controlling transcriptional programs involved in lipid homeostasis and inflammation. The inducible LXRA is highly expressed in liver, adrenal gland, intestine, adipose tissue, macrophages, lung, and kidney, whereas LXRB is ubiquitously expressed. Ligand-activated LXRs form obligate heterodimers with retinoid X receptors (RXRs; see MIM 180245) and regulate expression of target genes containing LXR response elements (summary by Korf et al., 2009 [PubMed 19436111]).[supplied by OMIM, Jan 2010] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Photoaffinity Labeling and Quantitative Chemical Proteomics Identify LXRβ as the Functional Target of Enhancers of Astrocytic apoE
,Seneviratne, U;Huang, Z;Am Ende, CW;Butler, TW;Cleary, L;Dresselhaus, E;Evrard, E;Fisher, EL;Green, ME;Helal, CJ;Humphrey, JM;Lanyon, LF;Marconi, M;Mukherjee, P;Sciabola, S;Steppan, CM;Sylvain, EK;Tuttle, JB;Verhoest, PR;Wager, TT;Xie, L;Ramaswamy, G;Johnson, DS;Pettersson, M;,
Cell Chem Biol
,PubMed ID 32997975
[NR1H2]
|
Fungal-derived neoechinulin B as a novel antagonist of liver X receptor, identified by chemical genetics using hepatitis C virus cell culture system
,Nakajima, S;Watashi, K;Ohashi, H;Kamisuki, S;Izaguirre-Carbonell, J;Tae-Jun Kwon, A;Suzuki, H;Kataoka, M;Tsukuda, S;Okada, M;Moi, ML;Takeuchi, T;Arita, M;Suzuki, R;Aizaki, H;Kato, T;Suzuki, T;Hasegawa, H;Takasaki, T;Sugawara, F;Wakita, T;,
J. Virol.
,PubMed ID 27489280
[NR1H2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402093 | NR1H2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402093 | Transient overexpression lysate of nuclear receptor subfamily 1, group H, member 2 (NR1H2) |
CNY 3,080.00 |
|
PH308381 | NR1H2 MS Standard C13 and N15-labeled recombinant protein (NP_009052) |
CNY 19,520.00 |
其它LXR beta产品