Interferon gamma (IFNG) (NM_000619) Human Recombinant Protein
CAT#: TP309993
Purified recombinant protein of Homo sapiens interferon, gamma (IFNG), 20 µg
View other "Interferon gamma" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209993 protein sequence
Red=Cloning site Green=Tags(s) MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQS QIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVM AELSPAAKTGKRKRSQMLFRGRRASQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000610 |
Locus ID | 3458 |
UniProt ID | P01579 |
Refseq Size | 1240 |
Cytogenetics | 12q15 |
Refseq ORF | 498 |
Synonyms | IFG; IFI; IMD69 |
Summary | This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Allograft rejection, Cytokine-cytokine receptor interaction, Graft-versus-host disease, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Proteasome, Regulation of autophagy, Systemic lupus erythematosus, T cell receptor signaling pathway, TGF-beta signaling pathway, Type I diabetes mellitus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400207 | IFNG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400207 | Transient overexpression lysate of interferon, gamma (IFNG) |
CNY 3,080.00 |
|
PH309993 | IFNG MS Standard C13 and N15-labeled recombinant protein (NP_000610) |
CNY 14,250.00 |
|
TP720013 | Recombinant protein of human interferon, gamma (IFNG) |
CNY 1,800.00 |
|
TP721239 | Purified recombinant protein of Human interferon, gamma (IFNG) |
CNY 1,800.00 |
|
TP723709 | Purified recombinant protein of Human interferon, gamma (IFNG) |
CNY 3,120.00 |
|
TP760490 | Purified recombinant protein of Human interferon, gamma (IFNG), with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它Interferon gamma产品