CD247 (NM_198053) Human Recombinant Protein
CAT#: TP314725
Recombinant protein of human CD247 molecule (CD247), transcript variant 1, 20 µg
View other "CD247" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214725 representing NM_198053
Red=Cloning site Green=Tags(s) MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQ LYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGL YQGLSTATKDTYDALHMQALPPR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_932170 |
Locus ID | 919 |
UniProt ID | P20963 |
Refseq Size | 1677 |
Cytogenetics | 1q24.2 |
Refseq ORF | 489 |
Synonyms | CD3-ZETA; CD3H; CD3Q; CD3Z; IMD25; T3Z; TCRZ |
Summary | The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403667 | CD247 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424538 | CD247 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403667 | Transient overexpression lysate of CD247 molecule (CD247), transcript variant 1 |
CNY 3,080.00 |
|
LY424538 | Transient overexpression lysate of CD247 molecule (CD247), transcript variant 2 |
CNY 3,080.00 |
|
PH306562 | CD247 MS Standard C13 and N15-labeled recombinant protein (NP_000725) |
CNY 19,520.00 |
|
PH314725 | CD247 MS Standard C13 and N15-labeled recombinant protein (NP_932170) |
CNY 19,520.00 |
|
TP306562 | Recombinant protein of human CD247 molecule (CD247), transcript variant 2, 20 µg |
CNY 2,900.00 |