Myosin Phosphatase 2 (PPP1R12B) (NM_032104) Human Recombinant Protein
CAT#: TP317905
Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 12B (PPP1R12B), transcript variant 4, 20 µg
View other "Myosin Phosphatase 2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217905 representing NM_032104
Red=Cloning site Green=Tags(s) MDKNENEEADLDEQSSKRLSIRERRRPKERRRGTGINFWTKDEDETDGSEEVKETWHERLSRLESGGSNP TTSDSYGDRASARARREAREARLATLTSRVEEDSNRDYKKLYESALTENQKLKTKLQEAQLELADIKSKL EKVAQQKQEKTSDRSSVLEMEKRERRALERKMSEMEEEMKNLHQLKQIQTLKQMNEQLQAENRALTRVVA RLSESIESSDTQEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115287 |
Locus ID | 4660 |
UniProt ID | O60237 |
Refseq Size | 2227 |
Cytogenetics | 1q32.1 |
Refseq ORF | 672 |
Synonyms | MYPT2; PP1bp55 |
Summary | Myosin phosphatase is a protein complex comprised of three subunits: a catalytic subunit (PP1c-delta, protein phosphatase 1, catalytic subunit delta), a large regulatory subunit (MYPT, myosin phosphatase target) and small regulatory subunit (sm-M20). Two isoforms of MYPT have been isolated--MYPT1 and MYPT2, the first of which is widely expressed, and the second of which may be specific to heart, skeletal muscle, and brain. Each of the MYPT isoforms functions to bind PP1c-delta and increase phosphatase activity. This locus encodes both MYTP2 and M20. Alternatively spliced transcript variants encoding different isoforms have been identified. Related pseudogenes have been defined on the Y chromosome. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Vascular smooth muscle contraction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410386 | PPP1R12B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410386 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 12B (PPP1R12B), transcript variant 4 |
CNY 3,080.00 |
|
PH317905 | PPP1R12B MS Standard C13 and N15-labeled recombinant protein (NP_115287) |
CNY 19,520.00 |
其它Myosin Phosphatase 2产品