Cep19 (NM_025892) Mouse Recombinant Protein

CAT#: TP501297

Purified recombinant protein of Mouse centrosomal protein 19 (Cep19), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR201297 protein sequence
Red=Cloning site Green=Tags(s)

MKYIAKKCGVRFQPPAVILIYENETEGKSRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVPLKQL
EKLFVFLRGSLQGQSLAETMEQIRRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKRKDDPTFVYDV
EVEFPQDEQLLSCSWDTASVDDF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 19.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080168
Locus ID 66994
UniProt ID Q9CQA8
Refseq Size 1701
Cytogenetics 16 B2
Refseq ORF 492
Synonyms 1500031L02Rik; AI428934; AL022620
Summary Required for ciliation. Recruits the RABL2B GTPase to the ciliary base to initiate ciliation. After specifically capturing the activated GTP-bound RABL2B, the CEP19-RABL2B complex binds intraflagellar transport (IFT) complex B from the large pool pre-docked at the base of the cilium and thus triggers its entry into the cilia. Involved in the early steps in cilia formation by recruiting the ciliary vesicles (CVs) to the distal end of the mother centriole where they fuse to initiate cilium assembly. Involved in microtubule (MT) anchoring at centrosomes.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...