Marchf8 (NM_027920) Mouse Recombinant Protein

CAT#: TP503891

Purified recombinant protein of Mouse membrane-associated ring finger (C3HC4) 8 (March8), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203891 protein sequence
Red=Cloning site Green=Tags(s)

MSMPLHQISAIPSQDAISARVYRSKTKDKEQNEKTLGHSMSHPSNISKAGSSPPSTTAPVSAFSRTSVTP
SNQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLRKWEK
LQMTASERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQVTGILEWPFWTKLVVVAIGFTGGLLF
MYVQCKVYLQLWKRLKAYNRVIYVQNCPETSKKNIFEKSALTEPTLENKEGHGMCHSTTNSSCTEPEDTG
AEIINV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_082196
Locus ID 71779
UniProt ID Q9DBD2
Refseq Size 4521
Cytogenetics 6 E3
Refseq ORF 861
Synonyms 1300017E09Rik; M; Marc; MARCH-VIII; March8; Mir
Summary The protein encoded by this gene is a member of the membrane-associated really interesting new gene-CH family of proteins. These proteins are E3 ubiquitin-protein ligases that modulate antigen presentation by downregulating major histocompatibility complex class II surface expression through endocytosis. The transcript is primarily expressed by dendritic cells and macrophages. Overexpression of this gene in antigen presenting cells results in immune defective phenotypes, including resistance to autoimmune disease onset. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...