Cyp27a1 (BC002183) Mouse Recombinant Protein
CAT#: TP506963
Purified recombinant protein of Mouse cytochrome P450, family 27, subfamily a, polypeptide 1 (cDNA clone MGC:7368 IMAGE:3487429), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR206963 protein sequence
Red=Cloning site Green=Tags(s) MWTTSFGTYTNVNLASAPLLEQVMRQEGKYPIRDHMDQWKDHRDHKGLTYGIFIAQGEQWYHLRQALKQR LLKPDEAALYTDALNEVISDFITRLDQVRAESESGDQVPDMAHLLYHLALEAITYILFEKRIGCLKPSIP EDTAAFIRSVAIMFQNSVYITFLPKWTRPLLPFWKRYLNGWDNIFSFGKKLIDEKVQELKAQLQETGPDG VRVSGYLHFLLTNELLSTQETIGTFPELLLAGVDTTSNTLTWALYHLSKSPEIQEALHKEVTGVVPFGKV PQHKDFAHMPLLKAVIKETLRLYPVVPTNSRIITEKETEINGFLFPKNTQFVLCHYVVSRDPSVFPEPNS FQPHRWLRKKEADNPGILHPFGSVPFGYGVRSCLGRRIAELEMQLMLSRLVQKYEIALAPGMGEVKTVSR IVLVPSKKVRLHFLQRQ SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-MYC/DDK |
Predicted MW | 50.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 104086 |
UniProt ID | Q9DBG1 |
Refseq Size | 1579 |
Cytogenetics | 1 38.54 cM |
Refseq ORF | 1311 |
Synonyms | 1300013A03Rik; Cyp27 |
Summary | Cytochrome P450 monooxygenase that catalyzes regio- and stereospecific hydroxylation of cholesterol and its derivatives. Hydroxylates (with R stereochemistry) the terminal methyl group of cholesterol side-chain in a three step reaction to yield at first a C26 alcohol, then a C26 aldehyde and finally a C26 acid. Regulates cholesterol homeostasis by catalyzing the conversion of excess cholesterol to bile acids via both the "neutral" (classic) and the "acid" (alternative) pathways. May also regulate cholesterol homeostasis via generation of active oxysterols, which act as ligands for NR1H2 and NR1H3 nuclear receptors, modulating the transcription of genes involved in lipid metabolism (By similarity). Plays a role in cholestanol metabolism in the cerebellum (PubMed:28190002). Similarly to cholesterol, hydroxylates cholestanol and may facilitate sterol diffusion through the blood-brain barrier to the systemic circulation for further degradation. Also hydroxylates retinal 7-ketocholesterol, a noxious oxysterol with pro-inflammatory and pro-apoptotic effects, and may play a role in its elimination from the retinal pigment epithelium. May play a redundant role in vitamin D biosynthesis. Catalyzes 25-hydroxylation of vitamin D3 that is required for its conversion to a functionally active form (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Cyp27a1产品