Cyp27a1 (BC002183) Mouse Recombinant Protein

CAT#: TP506963

Purified recombinant protein of Mouse cytochrome P450, family 27, subfamily a, polypeptide 1 (cDNA clone MGC:7368 IMAGE:3487429), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206963 protein sequence
Red=Cloning site Green=Tags(s)

MWTTSFGTYTNVNLASAPLLEQVMRQEGKYPIRDHMDQWKDHRDHKGLTYGIFIAQGEQWYHLRQALKQR
LLKPDEAALYTDALNEVISDFITRLDQVRAESESGDQVPDMAHLLYHLALEAITYILFEKRIGCLKPSIP
EDTAAFIRSVAIMFQNSVYITFLPKWTRPLLPFWKRYLNGWDNIFSFGKKLIDEKVQELKAQLQETGPDG
VRVSGYLHFLLTNELLSTQETIGTFPELLLAGVDTTSNTLTWALYHLSKSPEIQEALHKEVTGVVPFGKV
PQHKDFAHMPLLKAVIKETLRLYPVVPTNSRIITEKETEINGFLFPKNTQFVLCHYVVSRDPSVFPEPNS
FQPHRWLRKKEADNPGILHPFGSVPFGYGVRSCLGRRIAELEMQLMLSRLVQKYEIALAPGMGEVKTVSR
IVLVPSKKVRLHFLQRQ

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 50.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 104086
UniProt ID Q9DBG1
Refseq Size 1579
Cytogenetics 1 38.54 cM
Refseq ORF 1311
Synonyms 1300013A03Rik; Cyp27
Summary Cytochrome P450 monooxygenase that catalyzes regio- and stereospecific hydroxylation of cholesterol and its derivatives. Hydroxylates (with R stereochemistry) the terminal methyl group of cholesterol side-chain in a three step reaction to yield at first a C26 alcohol, then a C26 aldehyde and finally a C26 acid. Regulates cholesterol homeostasis by catalyzing the conversion of excess cholesterol to bile acids via both the "neutral" (classic) and the "acid" (alternative) pathways. May also regulate cholesterol homeostasis via generation of active oxysterols, which act as ligands for NR1H2 and NR1H3 nuclear receptors, modulating the transcription of genes involved in lipid metabolism (By similarity). Plays a role in cholestanol metabolism in the cerebellum (PubMed:28190002). Similarly to cholesterol, hydroxylates cholestanol and may facilitate sterol diffusion through the blood-brain barrier to the systemic circulation for further degradation. Also hydroxylates retinal 7-ketocholesterol, a noxious oxysterol with pro-inflammatory and pro-apoptotic effects, and may play a role in its elimination from the retinal pigment epithelium. May play a redundant role in vitamin D biosynthesis. Catalyzes 25-hydroxylation of vitamin D3 that is required for its conversion to a functionally active form (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...