Acer1 (NM_175731) Mouse Recombinant Protein

CAT#: TP517552

Purified recombinant protein of Mouse alkaline ceramidase 1 (Acer1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR217552 representing NM_175731
Red=Cloning site Green=Tags(s)

MHVPGTRAKMSSIFAYQSSEVDWCESNFQHSELVAEFYNTFSNVFFLIFGPLMMFLMHPYAQKRTRCFYG
VSVLFMLIGLFSMYFHMTLSFLGQLLDEISILWLLASGYSVWLPRCYFPKFVKGNRFYFSCLVTITTIIS
TFLTFVKPTVNAYALNSIAIHILYIVRTEYKKIRDDDLRHLIAVSVVLWAAALTSWISDRVLCSFWQRIH
FYYLHSIWHVLISITFPYGIVTMALVDAKYEMPDKTLKVHYWPRDSWVIGLPYVEIQENDKNC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_783858
Locus ID 171168
UniProt ID Q8R4X1
Refseq Size 2429
Cytogenetics 17 D
Refseq ORF 819
Synonyms 2310024P18Rik; AI662009; Alkcdase1; Asah3; Cer1
Summary Endoplasmic reticulum ceramidase that catalyzes the hydrolysis of ceramides into sphingosine and free fatty acids at alkaline pH (PubMed:12783875). Ceramides, sphingosine, and its phosphorylated form sphingosine-1-phosphate are bioactive lipids that mediate cellular signaling pathways regulating several biological processes including cell proliferation, apoptosis and differentiation (PubMed:12783875). Exhibits a strong substrate specificity towards the natural stereoisomer of ceramides with D-erythro-sphingosine as a backbone and has a higher activity towards very long-chain unsaturated fatty acids like the C24:1-ceramide (PubMed:12783875). May also hydrolyze dihydroceramides to produce dihydrosphingosine (By similarity). ACER1 is a skin-specific ceramidase that regulates the levels of ceramides, sphingosine and sphingosine-1-phosphate in the epidermis, mediates the calcium-induced differentiation of epidermal keratinocytes and more generally plays an important role in skin homeostasis (PubMed:27126290, PubMed:29056331).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...