US8A (NC_001798) Virus Tagged ORF Clone
CAT#: VC100934
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for membrane protein US8A [Human herpesvirus 2], codon optimized for human cell expression, NP_044539
View other clones from "Virus" (56)
Need custom modification / cloning service?
Get a free quote
CNY 3,800.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100934 represents NCBI reference of NP_044539 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGACCCCGCGCTGAGGAGTTATCACCAGCGGCTTCGCCTTTACACTCCAATCGCTCGAGGCGTGAATC TGGCAGCCAGAAGCCCTCCACTTGTGAGGGAGGCACGGGCAGTTGTCACTCCAAGACCTCCTATCCGCCC CTCATCAGGGAAGGCCAGCAGCGACGATGCCGATGTGGGGGACGAGCTGATTGCTATCGCTGATGCTAGA GGAGACCCTCCTGAGACCCTTCCTCCAGGTGCTGGAGGAGCAGCACCTGCGTGCAGGCGACCACCGCGGG GAGGATCACCAGCCGCCTTTCCAGTAGCTCTTCACGCCGTGGACGCTCCGAGCCAGTTTGTGACATGGTT GGCTGTGCGGTGGCTGAGAGGCGCTGTAGGTCTGGGCGCCGTCCTGTGCGGTATTGCTTTTTACGTAACG TCCATCGCTAGAGGCGCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100934 representing NP_044539
Red=Cloning sites Green=Tags MDPALRSYHQRLRLYTPIARGVNLAARSPPLVREARAVVTPRPPIRPSSGKASSDDADVGDELIAIADAR GDPPETLPPGAGGAAPACRRPPRGGSPAAFPVALHAVDAPSQFVTWLAVRWLRGAVGLGAVLCGIAFYVT SIARGA TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001798 |
ORF Size | 438 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_001798.1, NP_044539 |
RefSeq ORF | 438 bp |
Locus ID | 1487361 |
MW | 15.1 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100865 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 2], codon optimized for human cell expression, NP_044470 |
CNY 3,800.00 |
|
VC100866 | Myc-DDK-tagged ORF clone of viral ORF for uracil-DNA glycosylase [Human herpesvirus 2], codon optimized for human cell expression, NP_044471 |
CNY 3,990.00 |
|
VC100867 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL3 [Human herpesvirus 2], codon optimized for human cell expression, NP_044472 |
CNY 3,800.00 |
|
VC100868 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL4 [Human herpesvirus 2], codon optimized for human cell expression, NP_044473 |
CNY 3,800.00 |
|
VC100869 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase helicase subunit [Human herpesvirus 2], codon optimized for human cell expression, NP_044474 |
CNY 13,300.00 |
|
VC100870 | Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 2], codon optimized for human cell expression, NP_044475 |
CNY 10,260.00 |
|
VC100871 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 2], codon optimized for human cell expression, NP_044476 |
CNY 3,800.00 |
|
VC100873 | Myc-DDK-tagged ORF clone of viral ORF for DNA replication origin-binding helicase [Human herpesvirus 2], codon optimized for human cell expression, NP_044478 |
CNY 13,110.00 |
|
VC100874 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 2], codon optimized for human cell expression, NP_044479 |
CNY 5,856.00 |
|
VC100875 | Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 2], codon optimized for human cell expression, NP_044480 |
CNY 3,800.00 |
|
VC100877 | Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 2], codon optimized for human cell expression, NP_044482 |
CNY 6,270.00 |
|
VC100878 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 2], codon optimized for human cell expression, NP_044483 |
CNY 3,800.00 |
|
VC100879 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 2], codon optimized for human cell expression, NP_044484 |
CNY 11,020.00 |
|
VC100880 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 2], codon optimized for human cell expression, NP_044485 |
CNY 4,470.00 |
|
VC100882 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 2], codon optimized for human cell expression, NP_044487 |
CNY 3,800.00 |
|
VC100883 | Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 2], codon optimized for human cell expression, NP_044488 |
CNY 20,710.00 |
|
VC100884 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL20 [Human herpesvirus 2], codon optimized for human cell expression, NP_044489 |
CNY 3,800.00 |
|
VC100885 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL21 [Human herpesvirus 2], codon optimized for human cell expression, NP_044490 |
CNY 6,460.00 |
|
VC100886 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 2], codon optimized for human cell expression, NP_044491 |
CNY 12,730.00 |
|
VC100887 | Myc-DDK-tagged ORF clone of viral ORF for thymidine kinase [Human herpesvirus 2], codon optimized for human cell expression, NP_044492 |
CNY 4,470.00 |
|
VC100888 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL24 [Human herpesvirus 2], codon optimized for human cell expression, NP_044493 |
CNY 3,800.00 |
|
VC100889 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL25 [Human herpesvirus 2], codon optimized for human cell expression, NP_044494 |
CNY 7,030.00 |
|
VC100892 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein B [Human herpesvirus 2], codon optimized for human cell expression, NP_044497 |
CNY 13,680.00 |
|
VC100894 | Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human herpesvirus 2], codon optimized for human cell expression, NP_044499 |
CNY 18,050.00 |
|
VC100895 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase catalytic subunit [Human herpesvirus 2], codon optimized for human cell expression, NP_044500 |
CNY 18,810.00 |
|
VC100896 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 2], codon optimized for human cell expression, NP_044501 |
CNY 3,800.00 |
|
VC100898 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 2], codon optimized for human cell expression, NP_044503 |
CNY 3,800.00 |
|
VC100899 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 2], codon optimized for human cell expression, NP_044504 |
CNY 3,800.00 |
|
VC100900 | Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 2], codon optimized for human cell expression, NP_044505 |
CNY 3,800.00 |
|
VC100902 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 2], codon optimized for human cell expression, NP_044507 |
CNY 16,820.00 |
|
VC100903 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 2], codon optimized for human cell expression, NP_044508 |
CNY 5,700.00 |
|
VC100904 | Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 1 [Human herpesvirus 2], codon optimized for human cell expression, NP_044509 |
CNY 17,200.00 |
|
VC100905 | Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 2 [Human herpesvirus 2], codon optimized for human cell expression, NP_044510 |
CNY 3,990.00 |
|
VC100906 | Myc-DDK-tagged ORF clone of viral ORF for tegument host shutoff protein [Human herpesvirus 2], codon optimized for human cell expression, NP_044511 |
CNY 5,990.00 |
|
VC100907 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 2], codon optimized for human cell expression, NP_044512 |
CNY 5,700.00 |
|
VC100909 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein C [Human herpesvirus 2], codon optimized for human cell expression, NP_044514 |
CNY 5,890.00 |
|
VC100910 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL45 [Human herpesvirus 2], codon optimized for human cell expression, NP_044515 |
CNY 3,800.00 |
|
VC100911 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein VP11/12 [Human herpesvirus 2], codon optimized for human cell expression, NP_044516 |
CNY 10,830.00 |
|
VC100913 | Myc-DDK-tagged ORF clone of viral ORF for transactivating tegument protein VP16 [Human herpesvirus 2], codon optimized for human cell expression, NP_044518 |
CNY 5,488.00 |
|
VC100915 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 2], codon optimized for human cell expression, NP_044520 |
CNY 3,800.00 |
|
VC100916 | Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 2], codon optimized for human cell expression, NP_044521 |
CNY 4,370.00 |
|
VC100917 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 2], codon optimized for human cell expression, NP_044522 |
CNY 3,800.00 |
|
VC100918 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 2], codon optimized for human cell expression, NP_044523 |
CNY 16,150.00 |
|
VC100919 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein K [Human herpesvirus 2], codon optimized for human cell expression, NP_044524 |
CNY 4,090.00 |
|
VC100921 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL55 [Human herpesvirus 2], codon optimized for human cell expression, NP_044526 |
CNY 3,800.00 |
|
VC100922 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL56 [Human herpesvirus 2], codon optimized for human cell expression, NP_044527 |
CNY 3,800.00 |
|
VC100926 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein ICP22 [Human herpesvirus 2], codon optimized for human cell expression, NP_044531 |
CNY 5,130.00 |
|
VC100927 | Myc-DDK-tagged ORF clone of viral ORF for virion protein US2 [Human herpesvirus 2], codon optimized for human cell expression, NP_044532 |
CNY 3,800.00 |
|
VC100928 | Myc-DDK-tagged ORF clone of viral ORF for serine/threonine protein kinase US3 [Human herpesvirus 2], codon optimized for human cell expression, NP_044533 |
CNY 5,890.00 |
|
VC100930 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein J [Human herpesvirus 2], codon optimized for human cell expression, NP_044535 |
CNY 3,800.00 |
|
VC100931 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein D [Human herpesvirus 2], codon optimized for human cell expression, NP_044536 |
CNY 4,660.00 |
|
VC100932 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein I [Human herpesvirus 2], codon optimized for human cell expression, NP_044537 |
CNY 4,470.00 |
|
VC100933 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein E [Human herpesvirus 2], codon optimized for human cell expression, NP_044538 |
CNY 6,560.00 |
|
VC100935 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US9 [Human herpesvirus 2], codon optimized for human cell expression, NP_044540 |
CNY 3,800.00 |
|
VC100936 | Myc-DDK-tagged ORF clone of viral ORF for virion protein US10 [Human herpesvirus 2], codon optimized for human cell expression, NP_044541 |
CNY 3,800.00 |
|
VC100938 | Myc-DDK-tagged ORF clone of viral ORF for TAP transporter inhibitor ICP47 [Human herpesvirus 2], codon optimized for human cell expression, NP_044543 |
CNY 3,800.00 |